Published on

苦荣

bermain kartu-🎖️s128 ayam|XOXE88.COM

live ruleta

KomisionerKomnasHAMMohammadChoirulAnambicarapenundaanpemeriksaanujibalistik.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KomisiNasionalHakAsasiManusia(KomnasHAM)menundapemeriksaanhasilujibalistikolehPolriterkaitsenjataapi(senpi)yangdipakaidalambakutembakdirumahKadivPropamnonaktifPolriIrjenFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomnasHAMsedianyamemintaketeranganujibalistikdariPolripadaRabu(3/8),ditundbermain kartuamenjadiJumat(5/8).PenundaanjadwalitudisampaikanKomisionerKomnasHAMChoirulAnamdalamketerangantertulisyangditerimadiJakarta,Selasa(2/8).BacaJuga:HasilUjiBalistik,BharadaEPakaiGlock17,BrigadirJPistolHS9,SudutTembakan?Perubahan(jadwal)inidisampaikanolehKetuaTimKhususPolri,kataAnam.Diketahui,dalambakutembakdirumahFerdySambo,BrigadirJmemakaipistolHS9,sedangkanBharadaEmenggunakanGlock17.DiajugamenjelaskanalasanTimKhusus(Timsus)yangsebelumnyadibentukolehKapolriJenderalListyoSigitPrabowomemintapenundaanjadwalpermintaanketeranganolehKomnasHAM.BacaJuga:KematianBrigadirJSudah25Hari,AlArafSinggungsoalSenjataApiKarenamasihmembutuhkanwaktuuntukpersiapanbahanyangdiperlukanolehKomnasHAM,ucappriayangpernahaktifdiYLBHIitu.Anammengatakanperubahanjadwalitubisamemaksimalkanprosespemberianketerangan,sekaliguspendalamandatadanfaktadalammengungkapkasuskematianBrigadirYosuaHutabarataliasBrigadirJ.

PutraAmienRais,AhmadMumtazRais.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PerceraianputraAmienRais,AhmadMumtazdenganFutriZulyaSavitrimenjadiberitaterhebohentertainmentJPNNsepanjangSenin(1/8).BorokAhmadMumtazpundibongkarsetelahresmiberceraidenganFutriZulyaSavitri.Selainitu,Mumtazharusmemberikannafkahkepadamantanistrinyaitu.BacaJuga:TerungkapFaktaBarudalamPerceraianPutriZulkifliHasandenganAhmadMumtazRaisKemudian,penyebabutamaperceraianMumtazdanFutriZulyapundiungkap.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BorokAhmadMumtazDibongkarKelakuanPutraAmienRais,AhmadMumtazterbongkardalamrangkaiansidangceraidenganFutriZulyaSavitri,beberapawaktulalu.BacaJuga:PutriZulkifliHasandanMumtazRaisResmiBercerai,BeginiIsiPutusannyaDalamsidangcerai,FutrimembeberkansejumlahfaktamengenaisosokAhmadMumtazsaatmenjadisuaminya.Bacaselengkapnya:BorokPutraAmienRaisTerbongkarSetelahBerceraidariFutriZulyaSavitri,OhTernyataPutriDelinaAndrianySutisnadanayahnya,Sule.FototangkapanYouTubejpnn.com,JAKARTA-KomedianSulemengabarkankondisidirinyayangsedangdropkarenakelelahan.Bapaklimaanakituharusdiinfussupayabadannyasegerabugarkembali.Dalamkesempatan,Sulejugamemintaagarnetizentidaklagimenghubermain kartujatPutriDelina,yangdianggapsebagaipenyebabNathalieHolscermelayangkangugatancerai.BacaJuga:SalatTidakPakaiPeci,BagaimanaHukumnya?Buatteman-temanyangmasihmenghujatPutri,please,berhenti,kasihanPutri.KarenasemuapermasalahaninibukankarenaPutri,ituyangharuskaliantahu,kasihan,pintaSuleyangsedangterbaringdikursi.Anak-anakenggaktahuapa-apa,yangjelaskamibaik-baiksaja,tanpamenjatuhkansiapapun,sambungnya.Meskibegitu,PriakelahiranCimahiiniengganmembahasjikaadanetizenyangbertanyamengenaipenyebabperceraiannya,jikabukankarenaPutriDelina.BacaJuga:DihujatGegaraPodcastdenganPutriDelina,MaiaEstiantyPastikantakAkanHapusVideonyaKalauadayangbertanyaapadongmasalahnya,cukupaku,diadanTuhanyangtahu,enggakperlukamikasihtahu,lanjutnya.DaripadaPutriDelinayangdi-bully,pria45tahuninimempersilahkandirinyadihujat.

bermain kartu-🎖️s128 ayam|XOXE88.COM

AjudanIrjenFerdySambo,BhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEseusaimenjalanipemeriksaandikantorKomnasHAM,Jakarta,Selasa(26/7).Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-KomisiNasionalHakAsasiManusia(KomnasHAM)memeriksasatuorangajudanatauaidedecamp(ADC)danasistenrumahtanggaIrjenFerdySambopadaSenin(1/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Keduanyamenjalanipemeriksaanmulaisekitarpukul10.00WIBdanbaruselesaisekitarpukul17.15WIB.AjudanFerdySamboyangdiperiksaolehKomnasHAMpadaSeninkemarinsebelumnyaberhalanganhadir.BacaJuga:ArmanHarisUngkapKondisiTerkiniIstriFerdySamboPadaSelasa26Juli2022,KomnasHAMmengagendakanpemeriksaanterhadaptujuhorangajudanFerdySambo.Namun,hanyaenamyangdatangsalahsatunyaBharadaE.AgendaawalSenin(1/8),KomnasHAMjugaakanmemeriksaataumenggaliinformasidaripetugaskesehatanyangmelakukantesusapPCRdikediamanpribadiIrjenFerdySambodiJalanSaguling,DurenTigaJakartaSelatan.BacaJuga:IniHargaMobilMewahKomjenAgusyangMendatangiRumahFerdySambo,YaAmpun!Namun,kataKomisionerKomnasHAMRIBekaUlungHapsara,tenagakesehatanyangmelakukantesusapPCRtersebuttidakmemenuhiundanganpemeriksaan.Berikut5kabarterbaruperkembanganpengusutankasuskematianBrigadirNofriansyahYoshuaHutabarataliasBrigadirJyangdilakukanKomnasHAMhinggaSenin:Salat(Ilustrasi).Foto:Ricardo/jpnn.comjpnn.com-Salatmerupakankewajibanbagisetiaporangmuslimbalighdanberakal,kapanpundandimanapun.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Kewajibansalattidaktergoyahkanolehruang,waktudankeadaan.Namun,dalamrealitakehidupanmanusia,seringkalikesibukan-kesibukanmenjadikankitaterlena.BacaJuga:SalatTidakPakaiPeci,BagaimanaHukumnya?Sebenarnyaadabanyakhalyangmenjadikanseseorangbisamemperolehkeringanandiatas,misalnyamusafir(orangyangberpergiandengantidakadatujuanmaksiat).Olehkarenaitulahdalamfikihmengajarkansalatjamakdanqashar.Salatjamakadalahmengumpulkanduashalatdalamsatuwaktu,baikdilakukanpadawaktusalatpertama(jamaktaqdim)maupundilakukanpadawaktusalatyangkedua(jamaktakhir).BacaJuga:HukumBerhubunganBadandiWaktuyangTerlarangSedangkanqasharadalahmeringkassalatempatrakaatmenjadiduarakaatdengansyarat-syarattertentu,sepertisalatdhuhur,ashar,danisyak.Lalu,bagaimanasalatbagiorangyangsibukbekerja?KononbakaladapetisipenjarakanNikitaMirzani.IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-AdvokatIndraTarigansempatmengatakanbakalmembuatpetisipenjarakanNikitaMirzani.Dia,bahkanberencanamenggandeng200pengacaramembuatpetisitersebut.RekanIndraTarigan,AndyAmiruddinmengungkapkanakanmenembuskanpetisiitukeKapolri,KomisiIIIDPRRIhinggakePresidenJokoWidoao(Jokowi).BacaJuga:NikitaMirzaniHadiriWajibLapor,PolisiBilangBeginiKamitidakmain-maindalamhalini,ungkapAndyAmiruddin,diPolbermain karturesJakartaSelatanbeberapawaktulalu.Namun,hinggakinikabarkelanjutanmengenaipetisiitutidakterdengarkembali.PetisitersebutdibuatterkaitbatalnyapenahananNikitaMirzanidiPolrestaSerangKota.BacaJuga:PenampilanNikitaMirzaniSaatMenjalaniWajibLapordiKantorPolisi,JanganBerkedipPemainfilmNenekGayungitusempatdijemputpaksapetugassetelahmenjaditersangkaataslaporanDitoMahendra.Setelahsempatmenginapsatumalam,NikitaMirzaniakhirnyadibebaskandengansyaratwajiblaporkePolrestaSerangKota.KomisionerKompolnasPoengkyIndarti.Ilustrasi.Foto:ANTARA/Evarukdijatijpnn.com,JAKARTA-KomisiKepolisianNasional(Kompolnas)angkatbicarasoalaspirasimasyarakatyangmemintaIrjenFerdySambodinonaktifkandarijabatanKepalaSatgasKhusus(Kasatgassus)Polri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KompolnasmengatakanuntukmemastikanmengenaistatusjabatanlainKadivPropamnonaktiftersebutpihaknyaakanmemintaklarifikasikepalaPolri.KamiakankroscekdulukePolriapakahPakFerdySambomasihmenjabatKasatgassusatautidak,kataanggotaKompolnasPoengkyIndartisaatdihubungiANTARAdiJakarta,Selasa.Kompolnasmasukdalamjajarantimkhusus(Timsus)yangdibentukolehKapolriJenderalPol.ListyoSigitPrabowodalammengungkapperistiwapolisitembakpolisidirumahIrjenPol.FerdySamboyangmenewaskanBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.BacaJuga:LemkapiYakinFerdySamboSulitIntervensiPenyidikanPenembakanBrigadirJ,IniPenjelasannyaMenurutPoengky,meskiberadadidalamtimsus,posisiKompolnastetapberadadiluarsebagaipengawaseksternalyangmengawasipenanganankasustersebut.SebagaipengawaseksternalPolri,KompolnasmengetahuidanmemahamidesakanpublikterkaitobjektivitasPolridalammengungkapkasustersebut.TermasukdesakanmemintaIrjenPol.FerdySambountukdinonaktifkandarijabatansebagaiKepalaSatgassusPolri.Kamitahudesakanpublik,tetapikamijugaperluklarifikasikePolriterkaitmasihmenjabatatausudahtidaklagimenjabatnyaPakFerdysebagaiKasatgassus.Sehinggaharusdipastikanmelaluiklarifikasi,ujarnya.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriNamunKompolnassependapatdenganmasyarakatagarFerdySambodinonaktifkandarijabatansebagaiKepalaSatgassusPolriuntukmemperlancarprosespenyidikan.Seyogyanyauntukmemperlancarprosespenyidikanmemangperlunonaktifuntuksemuajabatan,untukmencegahkemungkinankonflikkepentingan,kataPoengky.Pemerintahmenyiapkan8kebijakandalampenyelesaianmasalahhonorer.Daripoin1hingga8menguntungkanpegawainon-ASN.IlustrasiASN:Ricardo/JPNN.comjpnn.com,JAKARTA-Pemerintahmulaimelakukanlangkah-langkahpenyelesaianmasalahpegawainon-aparatursipilnegara(ASN).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DimulaidariterbitnyaSEMenPAN-RBtentangstatuskepegawaiandiinstansipemerintahpusatdandaerah.SalahsatupoinmendasardalamSEyangditandanganiMenPAN-RBTjahjoKumolopada31Mei2022ituadalahhonorerditiadakanpada28November2023,danyangadahanyalahPNSdanPPPK.BacaJuga:MahfudMD:IngatBatasWaktuPendataanHonorer,TerlambatAdaKonsekuensinya Duabulanberselang,terbitlagiSEMenPAN-RBtentangpendataantenagaNon-ASNyangditandatanganiMahfudMDsebagaipelaksanatugaspada22Juli.Rentetankebijakantersebut,sebenarnyasudahdisampaikanPltMenPAN-RBMahfudMDdalamrapatkoordinasipembahasanpenyelesaiantenaganon-ASNdilingkunganinstansipemerintahpada24Juni.Dalamrakoryangdihadiriperwakilandarisekdaprovinsi,AsosiasiPemerintahKabupatenSeluruhIndonesia(APKASI),danAsosiasiPemerintahKotaSeluruhIndonesia(APEKSI)itu,MahfudMDmenyampaikanarahkebijakanpemerintahdalammenuntaskanmasalahtenaganon-ASN,yaitu:BacaJuga:6DokumenIniHarusDisiapkanuntukPendataanHonorer,SeluruhPegawaiNon-ASNPerluTahu 1.Pemetaanhonoreratautenaganon-ASNSaatini,pemerintahpusatdandaerahharusfokusmengaturstrategimenatapegawaidiinstansipemerintahuntukpercepatantransformasisumberdayamanusiatanpamenghilangkansisikemanusiaandanmeritokrasinya.Olehkarenanya,Mahfudmemintaparapejabatpembinakepegawaian(PPK)melakukanpemetaanhonoreruntukmelihatjumlahyangreal.

FutriZulyaSavitrisaatmendampingisangayah,ZulkifliHasanyangdilantikPresidenJokowimenjadiMenteriPerdaganganRIdiIstanaNegara,Jakarta,Rabu(15/6).Foto:DPPPANjpnn.com,JAKARTA-MantanistriAhmadMumtazRais,FutriZulyaSavitriresmibergantinamasecaranegaramenjadiPutriZulkifliHasan.HalinidiketahuisetelahPutrimendapatkansorotanpublikkarenaperceraiannyadenganputraAmienRaistersebut.AnakdaripolitikusZulkifliHasanitumengajukanpermohonangantinamakePengadilanNegeri(PN)JakartaSelatan.BacaJuga:TerbaringLemas,SuleMintaNetizenBerhentiMenghujatPutriDelinaBerdasarkanyangtercatatdalamSistemInformasiPenelusuranPerkara(SIPP)PNJakartaSelatan,Putrimengajukanpermohonanpada6Juni2022.Permohonantersebutlantasdikabulkanolehmajelishakimpada28Juni2022.SebagaimanadalamkutipanAkteKelahiran,(FutriZulyaSavitri)menggantinamamenjadiPutriZulkifliHasan,begitutertulisketeranganyangtercatatdiSIPPdengannomorperkara430/Pdt.P/2022/PNJKT.SEL.BacaJuga:JamakSalatKarenaSibukBekerja,BagaimanaHukumnya?Putrimelaluitigapersidangansebelumakhirnyamajelishakimmengeluarkanpenetapan.Meskitelahberganti,berbagaidokumenyangtelahtercatatdengannamaFutriZulyaSavitrimasihtetapberlakudimatanegara.KomisionerKomnasHAMMohammadChoirulAnambicarapenundaanpemeriksaanujibalistik.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KomisiNasionalHakAsasiManusia(KomnasHAM)menundapemeriksaanhasilujibalistikolehPolriterkaitsenjataapi(senpi)yangdipakaidalambakutembakdirumahKadivPropamnonaktifPolriIrjenFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomnasHAMsedianyamemintaketeranganujibalistikdariPolripadaRabu(3/8),ditundamenjadiJumat(5/8).PenundaanjadwalitudisampaikanKomisionerKomnasHAMChoirulAnamdalamketerangantertulisyangditerimadiJakarta,Selasa(2/8).BacaJuga:HasilUjiBalistik,BharadaEPakaiGlock17,BrigadirJPistolHS9,SudutTembakan?Perubahan(jadwal)inidisampaikanolehKetuaTimKhususPolri,kataAnam.Diketahui,dalambakutembakdirumahFerdySambo,BrigadirJmemakaipistolHS9,sedangkanBharadaEmenggunakanGlock17.DiajugamenjelaskanalasanTimKhusus(Timsus)yangsebelumnyadibentukolehKapolriJenderalListyoSigitPrabowomemintapenundaanjadwalpermintaanketeranganolehKomnasHAM.BacaJuga:KematianBrigadirJSudah25Hari,AlArafSinggungsoalSenjataApiKarenamasihmembutuhkanwaktuuntukpersiapanbahanyangdiperlukanolehKomnasHAM,ucappriayangpernahaktifdiYLBHIitu.Anammengatakanperubahanjadwalitubisamemaksimalkanprosespemberianketerangan,sekaliguspendalamandatadanfaktadalammengungkapkasuskematianBrigadirYosuaHutabarataliasBrigadirJ.IrjenFerdySambosaattibadigedungBareskrimPolri,Jakarta,Kamis(4/8),untukmenjalanipemeriksaanterkaitkasuskematianBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-BharadaRichardEliezerPudihangLumiuatauBharadaEsudahbeberapakkalimenjalanipemeriksaansebagaitersangkakasustewasnyaBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BharadaEmenyampaikansejumlahpoinpengakuanatauketeranganbarudihadapanpenyidikTimsusPolri.AntaralainsoalmotifpembunuhanterhadapBrigadirJ,anggotaBrimobyangmenjadiajudanistriFerdySambo,PutriCandrawathi.BacaJuga:BrigadirRickyRizalDitahan,IstriFerdySamboUngkapCintaTulusdiPinggirJalanPengacaraRichardEliezeratauBharadaE,DeolipaYumaramenyebutkliennyatidakpunyamotifmembunuhNofriansyahYosuaHutabaratatauBrigadirJ.Betul,yangbersangkutantidakpunyamotif,kataDeolipasaatdihubungi,Minggu(7/8).PengakuanBharadaEbahwadirinyatidakpunyamotif,kataDeolipa,tentunyabisamenjadipetunjukbagikepolisianmengungkapkasustewasnyaBrigadirJ.BacaJuga:RahasiaTangisanBuPutriCandrawathidiMakoBrimob,JanganDitahanBharadaEMengakuMendapatPerintahdariAtasanDeolipaYumarajugamengatakanBharadaEjugamengakumendapatperintahdariatasanuntukmembunuh.Dia(mengaku,red)diperintaholehatasannya.Ya,perintahnya,ya,untukmelakukantindakpidanapembunuhan,ucapDeolipamelaluilayananpesan,Minggu(7/8).

GandaputraMalaysiaAaronChia/SohWooiYikgagalnaikpodiumtertinggiCommonwealthGames2022.Foto:Twitter/@Badminton_Asiajpnn.com,BIRMINGHAM-KutukanbagigandaputraMalaysia,AaronChia/SohWooiYikterusberlanjut.Keduanyakembaligagalnaikpodiumtertinggi,kaliinidiajangCommonwealthGames2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Aaron/Sohsecaramengejutkankeokdisemifinaldaripasangantuanrumah,BenLane/SeanVendy(Inggris).WakilNegeriJiranitutumbanglewatpertarunganrubbergamedenganskor21-18,17-21,4-21diNationalExhibitionCentre,Birmingham.BacaJuga:KlasemenLigaInggrisSetelahMUKeokdanManCityBerjayaHasiliniterbilangmengejutkankarenasecaraperingkatAaron/SohberadajauhdiatasBen/Sean.WakilMalaysiaitusaatiniberadadirankingenamdunia,sedangkanBen/Seanmasihtercecerdiposisike-19.Takcumaitu,Aaron/SohjugamenyandangunggulanpertamaCommonwealthGames2022.BacaJuga:EriktenHagPujiCristianoRonaldo,TetapiSebutAda1KekuranganKekelahaninimenambahpanjangcatatankelambagiAaron/Soh.Hinggasaatini,keduanyabelumsekalipunnaikpodiumtertinggidalamturnameninternasional.Beruntung,Aaron/SohbisasedikitterhiburkarenaberhasilmerebutmedaliperungguCommonwealthGames2022.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat)mengomentarisoalstatusBrigadirRickysebagaitersangkapembunuhNofriansyahYosuaHutabarataliasBrigadirJ.Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-BrigadirRickyRizalatauBrigadirRR,ajudanPutriCandrawathi,istriIrjenFerdySamboditetapkansebagaitersangkadanlangsungditahandiRutanBareskrimPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirRRdijeratPasal340KUHPtentangPembunuhanBerencanaterhadapkasuskematianBrigadirNofriansyahYosuaHutabaratatauBrigadirJdirumahdinasIrjenFerdySambo.(RRdisangkakan)denganPasal340subsiderPasal338junctoPasal55danPasal56KUHP,kataKetuaTimPenyidikTimsusBareskrimPolriBrigjenAndiRianDjajadisepertidilansirAntara,Minggu(7/8).BacaJuga:JenderalBintang2IniSebutFerdySamboDijagaKetat,Selama30HarikeDepan,PerintahSiapa?DirekturTindakPidanaUmumBareskrimPolriitupenahananterhadapBrigadirRRterhitungmulaiMinggu(7/8)kemarin.Sebelumnya,TimPenyidikTimsusBareskrimPolritelahmenetapkanBhayangkaraDuaRichardEliezirPudihangLumiuatauBharadaEsebagaitersangkadengansangkaanPasal338KUHPjunctoPasal55danPasal56KUHP.PasaliniberbedadenganyangdisangkakankepadaBrigadirRR.BacaJuga:IniAlasanPolriAmankanFerdySambodiPatsusKorpsBrimob,OhTernyataKeduanyaditetapkansebagaitersangkaberdasarkanlaporanpolisiyangdilayangkankeluargaBrigadirJ,yakniterkaitdugaanpembunuhanberencanaPasal340KUHPjuncto338,juncto351ayat(3)juncto55dan56KUHP.AdapunpenerapanPasal55danPasal56terhadaptersangkaBhadaraEdanBrigadirRRdimungkinkanmasihadatersangkalainnyayangdidugaterlibatdalamkasusini.Ilustrasi-PasangansuamiistriFoto:Ricardo/JPNN.comjpnn.com-SeksologdrBoykeDianNugrahaSpOGmengakubanyakdidatangipasienpriaberusia30tahun,yangmengeluhsudahejakulasidini.Parapasientersebutmengakubingungkarenaalatvitalmerekasulitberdiridancepatmengeluarkancairan,padahalmasihmuda.AlumnusFakultasKedokteranUniversitasIndonesia(FKUI)inimengatakanejakulasidinidisebabkanmakananyangkerapdikonsumsi.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaMenurutdokterBoyke,banyakmengonsumsimakananinstanjugabisamenjadisalahsatupenyebabnya.Selainitu,Boykemenyarankanagarmerekamenerapkanpolahidupsehatdanmelatihcarabercinta.Kalaucowokyangsudahmatangdiabisamengaturkapanejakulasi.Durasinya,gerakannya,diabisaatur,tuturBoyke,dikanalWAWEntertainment.BacaJuga:Jerinx:Benar,SayaSempatDepresi,MerasaGagaljadiSuamiKeutamaanPuasaAsyuraBersertaNiatnyaPriakelahiran14Desember1956inijugamengungkapkancaraagarbisamencapaiklimaksbercinta.Jadi,ketikamauberhubungananggapitumain-main,ituadalahkehidupanyangmenyenangkan.Pokoknyanikmatiprosesnya,ungkpdrBoyke.(chi/jpnn)PolisiberjagadirumahdinasIrjenFerdySambo,KompleksPolriDurenTigasaatprarekonstruksikasusbakutembakpolisiyangmenewaskanBrigadirJ,Jakarta,Sabtu(23/7/2022).Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-KolumniskondangDahlanIskantidakcumamenyorotipelanggaranetikmantanKadivPropamPolriIrjenFerdySambodikasuspembunuhanYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MelaluitulisanberjudulMendungUdandikolomDisway,DahlanjugamengulasdramabarukasuspembunuhanBrigadirJ.MenurutDahlan,setelahIrjenSamboditahan,masihbanyakdramabaruyangakanterungkap,salahsatunyatelahdimulaiolehBharadaE,tersangkapembunuhanYosua.BacaJuga:DahlanIskanMeneleponMahfudMD,BeginikahNasibIrjenFerdySambo?HmmmBharadaEyangselamainidisebutmenembakBrigadirJsudahmenyangkalitu,demikiandikutipdariDiswayedisiSenin(8/8).TulisaninibertepatandengansebulantewasnyaBrigadirJdirumahdinasFerdySambo,kawasanDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.MenurutDahlandalamtulisanitu,BharadaEsudahmulaitidaksungkanuntuktidakmenjalankanskenariosutradara.BacaJuga:DiancamAkanDihabisi,ARTBakalBertanyaLangsungkepadaKapolriDIapunmempertanyakanapakahistriIrjenFerdySambo,PutriCandrawathiakankonsistendenganskenariodilecehkansecaraseksual.Kelihatannyaskenariopelecehanseksualiniakanruntuhjuga.SetidaknyabegitulahdoapacarBrigadirJ,VeraSimanjuntak,demikiandikutipdariDisway.

MantanKadivPropamPolriIrjenFerdySamboditahandiMakoBrimob.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-KolumniskondangDahlanIskanmenyorotipelanggaranetikmantanKadivPropamPolriIrjenFerdySambodikasuspembunuhanYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});IrjenFerdySambodianggapmelanggarprosedurdalampenanganantempatkejadianperkara(TKP)tewasnyaBrigadirJ,yaitudirumahdinasjenderalbintangduaitu.DalamtulisanDiswayberjudulMendungUdan,DahlanmenulismomentumklimakskelihatansudahdekatdenganditahannyasuamiPutriCandrawathiitu.BacaJuga:DiancamAkanDihabisi,ARTBakalBertanyaLangsungkepadaKapolriYangsempatbikinbingungadalahsangkaannya:hanyamelanggarkodeetik.Bukanpidana.Bukankejahatan.Bukanpembunuhan,dikutipdariDiswayedisiSenin(8/8).TulisanitubertepatandengansebulankematianBrigadirJyangtewasdirumahdinasSambo,DurenTiga,JakartaSelatanpadaJumat(8/7)lalu.Dahlanmenilaikebingunganpublikberalasan.Sebab,sanksipelanggaranetikhanyasoalstatuskeanggotaan.BacaJuga:BrigadirRickyRizalDitahan,IstriFerdySamboUngkapCintaTulusdiPinggirJalanKalaupelanggaranetiknyasangatberat,keanggotaannyabakaldicabutsecarapermanenaliasdipecat.Dipecat,sepertidrTerawandalamhalVaksinNusantara.DiadipecatdarikeanggotaanIkatanDokterIndonesia(IDI),lanjuttulisanDahlan.NoraAlexandramemamerkanfotomesrabersamasuaminya,Jerinxyangbarusajabebasdaripenjara.Foto:Instagram/ncdpapljpnn.com,JAKARTA-MusikusJerinxSIDmerasagagalmenjadisuamidansempatdepresi,karenaduakalimasukpenjaradisaatusiapernikahannyadenganNoraAlexandra,masihseumurjagung.Jerinxbersyukur,sangistritakmeninggalkannyameskibanyaktekananyangditerimaNora.Sebab,banyakfansJerinxyangmenyebutnyasebagaipembawasialbagipentolanSIDitu.Priabertatoitumenyebuttidakadapernikahanyangsempurna.Jikapunada,hanyadifilm-filmfiksi.BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBeginiPernikahanadalahperihalpenyatuan2egoagarbertemudisatugariskeselarasanyangharmonis.Terdengarsimpeltapiaslinyaruwetmintaampunkarenasejatinyaisikepalamanusiatidakadayangbenar-benar100%sama.Sebuahpernikahanakandiujiketikaiasedangmengalamimasalahdancobaan,tulisJerinxlewatakunInstagram,Sabtu(6/8).Selainitu,perbedaanusiadirinyadenganNorayangterpauthingga18tahun,takbanyakmembantusaatmerekaditerjangmasalah.Pernikahankamicobaannyasungguhnyata.Darisebelumdansesudahmenikahsudahditerjangmasalahdemimasalahyangcukupserius.Jarakusiayang18tahunjugatidakbanyakmembantuketikatertimpamasalah.Kamiberduaadalahapi.Sayaterlalulamaterlibatdiduniaaktivismeyangcenderungtoxicdankeras.Istrijugasejaklahirtumbuhdilingkunganyangkeras.Jadinyayasama-samakeras,tuturnya.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaSaatberadadisituasiyangserbatertekan,JerinxmengakuiNoraAlexandrasungguhkuatdansetialuarbiasa.SebabbarusepuluhbulandipenjarakarenakasusIDI,JerinxkembalimasukbuikarenakasusdenganAdamDeni.

bermain kartu-🎖️s128 ayam|XOXE88.COM

KabareskrimPolriKomjenAgusAndriantoFoto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KabareskrimPolriKomjenAgusAndriantomenyebutakanadatersangkabarudalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});TersangkabaruiniakandiumumkanlangsungolehKapolriJenderalListyoSigitPrabowobersamatimkhusus(timsus).TunggupengumumanPakKapolridantimkhususbesok(Selasa),katadiaketikadikonfirmasi,Senin(8/8).BacaJuga:GegaraBrigadirRicky,KomnasHAMTakLangsungPercayadenganKeteranganAjudanFerdySamboNamun,salahsatuanggotatimsusitubelummaumemerincisoalsiapatersangkabaruyangakandiumumkantersebut.DiahanyameyakinikasuskematianBrigadirJdirumahdinasIrjenFerdySamboituakansegeratuntas.Insyaallahtuntas,katamantanKapoldaSumateraUtaraitu.BacaJuga:SoalPenembakandiRumahFerdySambo,Teddy:PembantuPresidenIkutanLatahJadiHakimDalamkasusiniPolritelahmenetapkanduaorangtersangka,yakniBhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEdengansangkaanPasal338KUHPjunctoPasal55danPasal56KUHP.TersangkakeduaadalahBrigadirRickyRizalatauBrigadirRR,disangkadenganPasap340KUHP(pembunuhanberencana)junctoPasal338junctoPasal55danPasap56KUHP.PetugasSatreskrimPolrestaBanyumasmemeriksaseorangpriaberinisialTT(51)yangditangkapkarenamenjualistrinyauntukmelayaninafsusejumlahprialain.ANTARA/HO-PolrestaBanyumasjpnn.com,PURWOKERTO-TT(51)ditangkapSatuanReserseKriminalPolrestaBanyumas,PoldaJawaTengah.Diadidugamenjualistrinyamelayaninafsusejumlahpria.WargaKabupatenBanyumas,Jateng,ituditangkapdiYogyakarta1Agustus2022.BacaJuga:SuamidiSurabayaJualIstrikePriaHidungBelang,MotifnyaTernyataKasusiniterungkapsetelahistripelaku,I(35),melaporkanperbuatansuaminyakepadakamipadaMei2022,kataKepalaSatreskrimPolrestaBanyumasKompolAgusSupriadiSiswantodiKantorSatreskrim,Purwokerto,KabupatenBanyumas,Senin(8/8)siang.Diamengatakansetelahmenerimalaporanitu,pihaknyamelakukanpenyelidikandanmencarikeberadaanpelakuyangkabursetelahmengetahuiistrinyamelaporkanperbuatannyakepadapolisi.KompolAgusmenegaskanpelakuditangkappetugasSatreskrimPolrestaBanyumasdiYogyakartapada1Agustus2022.BacaJuga:DihajarSuami,NelliMengadukeRumahPakRTLaluMeninggal,IniPelakunyaMenurutdia,sejauhiniadatigapriayangdilayaniolehkorbanatasperintahdandibawahancamandaripelaku.Tigapriamerupakanorangdekatataurekandarisuamikorban.Penjara(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Utang-piutangdiperbolehkandalamIslamkarenatermasukakadtaawun(tolongmenolong),untukyangmembutuhkanbantuandanjugamerupakanakadtabarru(sosial),sebagaikepedulianmembantuorang-orangyangsedangdalamkesulitan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Lalubagaimanadenganhartahasilkorupsi,masihkahharusdikembalikankenegara,sementarapelakunyasudahdipenjara?Parapelakuusahayangmengakutelahmengalamipailit,tidaklahgugurbegitusaja.SecarahukumIslam,utangpadadasarnyamerupakanbagiandariamanahyangtetapwajibdikembalikankepadapihakkrediturketikatelahjatuhtempo.BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBeginiNabiMuhammadSAWbersabdamenunda-nundapelunasanutangolehseorangyangmampumelunasinyamerupakanbentukkezaliman(mathlual-ghaniyyidhulmun).Istilahlaindarikezalimaniniadalahmoralhazard.DalamtuntunanagamaIslam,seorangkreditur(pemilikpiutang)ketikamenghadapikasusadanyapihakdebitur(pemilikutang)dianjurkanagarmemberirelaksasihinggaseseorangmenjadimampu(QSAl-Baqarah[2]:182).BacaJuga:Jerinx:Benar,SayaSempatDepresi,MerasaGagaljadiSuamiNamun,ketikamenghadapiadanyakasusmoralhazardberupaupayauntukmengulur-ulurwaktusehinggamerugikankrediturataunegara,makapihakpemerintahberwenangmelakukantadib(pendidikanmoral)terhadapmereka.Adabeberapacaramemberikantadibterhadapdebituratauobligoryangnakalsemacaini,antaralaindenganjalandipenjara(habsun),diambilhartanyasecarapaksa(disita)(bial-qahri),ataubahkandenganjalanditahanpenyaluranhartanya(hajr).KuasahukumBharadaE,DeolipaYumaramenjawabdiplomatissaatdisinggungperihalatasankliennyamemerintahkanuntukmenembakBrigadirJ.JawabanitudisampaikannyadiBareskrimPolri,Senin(8/8).Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-BhayangkaraDuaRichardEliezeraliasBharadaEmengakumenembakBrigadirNofryansahYosuaHutabarataliasBrigadirJatasperintahatasannya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});InsidenyangmenewaskanBrigadirYosuaituterjadidirumahdinasIrjenFerdySambo,KomplekDurenTiga,JakartaSelatanpadaJumat(8/7).Lantas,siapasosokatasanBharadaEyangmemerintahkanuntukmenembakaBrigadirJitu?BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraKuasahukumBharadaE,DeolipaYumaramenjawabdiplomatissaatdisinggungperihalatasankliennyaitu.Deolipamengatakanhaltersebutmerupakankewenanganpenyidik.Itusudahmasukkesubstansimateriil,sudahbukankewenangansayamenjawab,tetapikewenangandaripenegakhukumyanglainyaitukepolisian,kataDeolipadiBareskrimPolri,Senin(8/8)malam.BacaJuga:KeteranganBharadaEBerubahTotal,DuluMengakuEksekutor,Sekarang?Disisilain,DeolipaengganmengungkappengakuankliennyalebihdetailkarenaitusubstansimaterillperkarakasuskematianBrigadirJ.Salahsatukewenangandalampenyidikanyangsifatnyamateriiladalahkewenangandaripadapenyidikpolisi.Kalauformilkamibisa,ujarDeolipa.

KetuaKomnasHAMAhmadTaufanDamanik.AristoSetiawan/jpnnjpnn.com,JAKARTAPUSAT-KetuaKomisiNasionalHakAsasiManusia(HAM)AhmadTaufanDamanikmengakutidakmudahpercayadenganketeranganaidedecamp(ajudandanasistenrumahtangga)mantanKadivPropamIrjenFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MenurutTaufan,merekabisasajaberbohongsoalkejadianyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratpada8Juli2022lalu.Apakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ucapTaufandiKomnasHAM,JakartaPusat,Senin(8/8).BacaJuga:SoalPenembakandiRumahFerdySambo,Teddy:PembantuPresidenIkutanLatahJadiHakimPria57tahunitupunmendesakkamerapengawasatauCCTVditempatkejadianperkarauntuksegeradibukakarenamenjadialatbuktiutama.MakanyasayadesakCCTVharusdibuka,alatkomunikasidibuka,karenakalaucumaketeranganorangdemiorang(tidakkuat),jelasnya.KetidakpercayaanTaufansemakindiperkuatlantaranBrigadirRickyRizalditetapkansebagaitersangka.HalinimembuktikanbahwaketeranganRickysaatdiperiksaKomnasHAMtidakbenar.BacaJuga:KeteranganBharadaEBerubahTotal,DuluMengakuEksekutor,Sekarang?Saatdiperiksa,RickymengakudirinyabersembunyidibalikkulkassaatperistiwapenembakanBrigadirJterjadi.Namunolehpolisi,Rickyjustruditetapkansebagaitersangkadengansangkaanterlibatpembunuhanberencana.TimkuasahukumBhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEmenyambangiBareskrimPolri,Senin(8/8)malam.IlustrasiFoto/dok:Ricardo/JPNN.comjpnn.com,JAKARTA-TimkuasahukumBhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEmenyambangiBareskrimPolri,Senin(8/8)malam.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KedatanganduapengacaraBharadaE,yakniDeolipaYumaradanMuhammadBurhanuddindalamrangkaberkoordinasidenganpenyidikmengenaikasuspembunuhanBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.PengacaraeksajudanIrjenFerdySamboitumendadaktibadiBareskrimPolripukul20.46WIB.Sebelumnya,merekamenjadwalkankunjungankeBareskrimpadaSelasa(9/8)besok.BacaJuga:BharadaEJadiTersangkadanDitahan,BagaimanaKondisiKeluarga?Kedatangankamitentunyakepentingan-kepentinganuntukmenanganiperkara-perkara,salahsatumenanganiperkaraialahdengancaraberkoordinasi,kataDeolipadiBareskrimPolri.DeolipamengakubanyakhalyangingindikoordinasikandenganpenyidikPolri.Salahsatunya,lanjutdia,terkaitjusticecollaborator(JC)BharadaEyangsudahdiajukankepadaLembagaPerlindunganSaksidanKorban(LPSK)pagitadi.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraSelainitu,lanjutdia,pertemuanmalaminidimungkinkanuntukmenambahBeritaAcaraPemeriksaan(BAP)yangsudahdisampaikanBharadaE.Namun,diamemastikantidakadapernyataankliennyayangberubahhariini.SkuadPSMMakassardalamsebuahlagadiLiga12022/23.Foto:LigaIndonesiaBaru.jpnn.com,MAKASSAR-PSMMakassarakanmenjamuKedahFCpadasemifinalAFCCup2022zonaASEAN.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});PertandinganiniakanberlangsungdiStadionKaptenIWayanDipta,GianyarBali,Selasa(9/8/2022).DuelPSMvsKedahFCdiprediksibakalketatsangsengit.Sebab,keduatimsama-samaberambisimerebutkemenanganagarloloskebabakberikutnya.BacaJuga:PelatihKedahFCTebarAncamankePSMMakassar,Sorot1PemainDalamlagaini,PSMmaupunKedahFCbakalmenurunkanskuadterbaiknya.Kamiakanbekerjaekstrakerasuntukmeraihkemenangan,kataPelatihPSMMakassar,BernardoTavares,Senin(8/8/2022)siang.TimtertuadiIndonesiaitukemungkinanmenurunkanEvertonNascimento,YakobSayuri,danRezkiEkadilinidepan.BacaJuga:SambutHUTke-77RI,PelatihPSMMakassarPunyaPesanPentinguntukSuporterKemudian,PSMbakalmengandalkanWiljanPluim,RasyidBakri,sertaArfanditengah.Sementaraitu,YuranFernandes,ErwinGutawa,YanceSayuri,danAgungMannanakanmenjagabentengpertahananPasukanRamang.Terakhir,RezaAryaPratamabakalmenjadipemainterakhirdibawahmistar.PetugaspemadamkebakaranberjibakumemadamkanapiyangmembakarMazdaCX7.Foto:CuciHati/jpnn.comjpnn.com,ILIRBARAT-MobilSUVMazdaCX7nomorpolisiD1584IYwarnaputihterbakardiJalanHuluBalang,KelurahanDemangLebarDaun,KecamatanIlirBaratI,Palembang,Senin(8/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1600966010670-0);});PemilikmobilOscarFauzi(42),wargaJalanBankRayaII,KelurahanDemangLebarDaunmengungkapkankronologikejadianbermulasekitarpukul14.30WIBseusaimengisibahanbakarminyak(BBM)PertamaxdiSPBUJalanHuluBalang.SetelahmengisiBBMterdengarsuaraletusandaribandepankananmobil,kemudianmunculapi.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanOscarbersamaistridanketigaanaknyalangsungkeluardarimobiluntukmenyelamatkandiri.Jadi,awalmulaituadasuaraletusandaribandepankanan,kemudianapitiba-tibamuncul,sayabersamaistridanketigaanakkeluar,mobilpunmeledakdanterbakar,ungkapdia.Oscarmengakusebelumkejadiantidakadakejanggalandimobil.BacaJuga:SiswaSMPTewasDitusukdiSekolah,PelakunyaTakAdayangMenyangkaWaktuperjalanandarirumahtidakadatanda-tandakejanggalanapa-apa.Mobilinijugasebenarnyajarangdipakai,karenahabisbensinmakanyamaudiisi,jelasnya.SatuunitmobilPemadamKebakaran(Damkar)PemkotPalembangdidatangkanuntukmemadamkanapi.

TunggalputriIndia,PusarlaV.Sindhu..Foto:BadmintonPhoto-BWFjpnn.com,BIRMINGHAM-IndiamemborongtigamedaliemasdariajangCommonwealthGames2022yangdihelatdiBirmingham,Inggris.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});TigawakilIndiayangsuksesnaikpodiumtertinggiantaralainLakshyaSen(tunggalputra),PusarlaV.Sindhu(tunggalputri),sertaChiragShetty/SatwiksairajRankireddy(gandaputra).LakshyaSenmerebutemasseusaimengalahkantunggaputraMalaysia,NgTzeYong.BacaJuga:AFCCup2022:PrediksiSusunanPemainPSMMakassarvsKedahFCPemainranking10duniaitumengalahkanTzeYonglewatpertarungantigagimdenganskor19-21,21-19,21-16.KemenanganSendiikutiolehrunnerupOlimpiadeRio2016,PusarlaV.Sindhu.KampiunSingaporeOpen2022itumenangdenganskor21-15,21-13atasMichelleLi(Kanada).SatulagiwakilIndiayangberjayadiCommonwealthGames2022ialahChiragShetty/SatwiksairajRankireddy.BacaJuga:CommonwealthGames2022:NgTzeYongMenggila,LeeChongWeiBeriPetuahPentingJawaraIndiaOpen2022itumengatasiperlawananwakiltuanrumahBenLane/SeanVendyduagimlangsung,21-15,21-13.Dengankemenanganini,Indiatercatatmembawapulangtigamedaliemasdarisektorperorangancaborbulutangkis.HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).FotoIlustrasi:Ricardo/JPNN.comjpnn.com,JAKARTA-HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});InvestasisafeheavenberbalikmenguatdaripenurunanakhirpekanlaludanbertenggerdiataslevelpsikologisUSD1.800perounce.PenguatanhargaemasditopangolehgreenbackyanglebihlemahmenjelanglaporaninflasiutamaAmerikaSerikat.BacaJuga:HargaEmasPegadaian,Sabtu6Agustus2022,AntamdanUBSKompakNaikKontrakemaspalingaktifuntukpengirimanDesemberdidivisiComexNewYorkExchange,terdongkrakUSD14atau0,78persen,menjadiditutuppadaUSD1.805,20perounce.EmasberjangkaanjlokUSD15,7atau0,87persenmenjadiUSD1.791,20padaJumat(5/8),setelahmelonjakUSD30,5atau1,72persenmenjadiUSD1.806,90padaKamis(4/8).IndeksUSDyangmengukurgreenbackterhadapenammatauangutamalainnya,turun0,17persenmenjadi106,4360,karenainvestormenunggudatainflasiASyangakandirilispadaRabu(10/8),membuatemaslebihmurahbagipemegangmatauanglainnya.BacaJuga:HargaEmasHariIniMerosotTajam,AmbyarEmasjugamenemukandukungantambahandariimbalhasilobligasipemerintahASyangturundanpembalikankeuntunganawalpadasaham-sahamAS.JikaWallStreetdanaset-asetberisikotetapdalamtrenpasarbearish,makakitaharusmengabaikansinyalinidenganrisikokitasendiri,kataanalisekuitasStoneX,FawadRazaqzadadalamkomentarnyapadaSenin(8/8).

bermain kartu-🎖️s128 ayam|XOXE88.COM

PengacaraBharadaE,DeolipaYumaradanMuhammadBurhanuddindikantorLPSK,JakartaTimur,Senin(8/8).jpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangSenin(8/8)tentangBharadaEmengakusudahlegakarenamembongkarkasusBrigadirJ,sementaraituDahlanIskanmenuliskanrahasiabesarsoalkasusBrigadirJ,hinggaselainpelecehanseksualDahlanjugamenuliskansoalurusancintaPutriCandrawathi.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarBacaJuga:5BeritaTerpopuler:BharadaESudahBicara,CampurTanganFerdySamboTerungkap,MasihAdaKejutanLainKolumniskondangDahlanIskanpunpenasarandenganmotifdibalikkasuspembunuhanYosuaHutabarataliasBrigadirJdirumahmantanKadivPropamPolriIrjenFerdySambo.MelaluitulisanberjudulMendungUdandikolomDisway,DahlanmulanyamenyinggungtentangskenariopelecehanseksualhinggasoalhubungancintaBrigadirJdengansangkekasihVeraSimanjuntak.DiapunmempertanyakanapakahistriFerdySambo,PutriCandrawathiakankonsistendenganskenariodilecehkansecaraseksual.BacaJuga:5BeritaTerpopuler:IrjenFadilImranBicaradenganPresiden,PasukanBrimobBergerak,AdaTumbalpadaKasusBrigadirJ?Bacaselengkapnya,kliklinkdibawah:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarRezaIndragiri.IlustrasiFoto:AndikaKurniawan/JPNN.comjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielmenilaipemunculanistriIrjenFerdySambo,PutriCandrawathidiMakoBrimob,KelapaDua,Depok,Minggu(7/8)sebagaiproblematik.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalituterkaitbenartidaknyaterjadikejahatanseksualolehBrigadirJterhadapPutriCandrawathidirumahdinasmantanKadivPropamPolri,DurenTiga,JakartaSelatanpadaJumat(8/7)lalu.PutriCandrawathi(kanan)didepanMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianBacaJuga:DahlanIskanSinggungSkenarioPelecehanSeksualPutriCandrawathidanUrusanCintaRezamengatakandariseluruhkorbankecelakaanlalulintas,15persenmengalamiguncanganjiwa.Sementaraitu,dalamkasuskejahatanseksual,korbanyangterguncangberatmencapai80persen.Satudatainisajasudahmenunjukkankeseriusankejahatanseksual.Korbansudahsepatutnyaditolong.Hak-haknyadipenuhi,ucapRezakepadaJPNN.com,Senin(8/8).BacaJuga:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarAkantetapi,lanjutReza,apakahdalamkasusDurenTigabenar-benaradakejahatanseksual?Tentuperlumenungguhasilinvestigasikepolisian.Namun,RezamelihatadayangproblematikdaripemunculanistriFerdySambodidepanmediaketikamendatangiMakoBrimob.TerlebihPutridisebut-sebuttelahmengalamipelecehanseksual.

PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-SuratIzinMengemudi(SIM)memilikimasaberlakuselama5tahunsetelahdibuat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});UntukandayangberdomisilidiJakartadaninginmemperpanjangdokumentersebut,DirektoratLaluLintasPoldaMetroJayamenyediakanlayananSIMKeliling.Dilansirdariakunresmi@TMCPoldaMetrodiInstagram,pihakPMJmenyiapkan5gerailayananSIMyangtersebardi4wilayahkotaDKIJakarta,Selasa(9/7).BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaPusatbisamemperpanjangSIMdiKantorPosLapanganBanteng.Kemudian,wargayangtinggaldiwilayahJakartaBaratpelayananSIMkelilingdibukadiLTCGlodokdanMallCitraland.BagiyangberdomisilidiJakartaSelatanbisamengaksesSIMkelilingdiKampusTrilogiKalibata.BacaJuga:LokasiLayananSIMKelilingdiJakartaHariIni,Ada5GeraiTerakhir,wargaJakartaTimurbisamenujukeGrandMallCakung.LayananSIMKelilinginiberoperasimulaipukul08.00hinggapukul14.00WIB.SejumlahajudandanpengurusrumahtanggaIrjenFerdySambosaatmenjalanipemeriksaandiKantorKomnasHAM,Jakarta,Senin(1/8).Foto:Ricardo/JPNNjpnn.com,JAKARTAPUSAT-BrigadirRickyRizalatauRRsudahditetapkansebagaitersangkadalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Denganadanyapenetapantersangkaini,terungkapdiasudahberbohongdalamkesaksiannyapadaKomnasHAMbeberapawaktulalu.Dalamketerangannya,BrigadirRickymengakutahuadabakutembakantaraBharadaEdanBrigadirJ.Namun,BrigadirRickyhanyabersembunyidibalikkulkas.BacaJuga:HariIniKapolriUmumkanTersangkaBaruKasusBrigadirJ,KomjenAgus:InsyaallahTuntasHalinijugasudahdiungkapkanolehKetuaKomnasHAMAhmadTaufanDamanik.RickymengatakandiabersembunyidibalikkulkaskanRickyyangbilang,bukansaya,sayakatakanayodiuji.SekarangpenyidikmenjadikandiatersangkaPasal340KUHP,pembunuhanberencanaitu,ujarTaufankatadiakepadawartawandiJakartaPusat,Senin(8/8).MenurutTaufan,kebohonganitumembuatmerekamenjaditidakmudahpercayadenganketeranganparaajudanIrjenFerdySambo.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraApakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ujarpriaberusia57tahunBareskrimPolrimenetapkanBrigadirRickyRizalsebagaitersangkadalampembunuhanBrigadirJ.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-TimKhususPolritelahmenetapkanBrigadirRRatauRickyRizal,ajudanPutriCandrawathi,istriIrjenFerdySambo,sebagaitersangkadalamkasusdugaanpembunuhanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutkanalasanBrigadirRRsebagaitersangkakasuspolisitembakpolisiitu.Alasannya,duaalatbuktisudahcukupuntukmenetapkanstatusnyasebagaitersangka,kataBrigjenAndisaatdikonfirmasidiJakarta,Senin(8/8).BacaJuga:MabesPolriBanjirKaranganBunga,MasyarakatMintaKasusBrigadirJSegeraDituntaskanHanyasaja,Anditidakmemerinciduaalatbuktitersebutapasaja,danbagaimanaperanBrigadirRRdalamperistiwapenembakanyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratdirumahdinasKadivPropamPolridiKomplekPolriDurenTiga,JakartaSelatanpadaJumat(8/7).Itumateripenyidikan,bukanuntukpublikasi,ujarketuaTimPenyidikanTimKhususBareskrimPolriitu.Sebelumnya,penyidikBareskrimPolritelahmenahansopirdanajudanPutriCandrawathi,istriIrjenFerdySambo,berisinialBharadaREdanBrigadirRR.BharadaREadalahBharadaRichardEliezerPudihangLumiuatauBharadaEyangsudahditetapkansebagaitersangkadandilakukanpenahananpadaRabu(3/8).SedangkanBrigadirRRditahanmulaiMinggu(7/8)diRumahTahanan(Rutan)BareskrimPolri.BacaJuga:BrigadirRickyMengakuCumaMenyaksikanSebagianPeristiwa,KiniJadiTersangkaPembunuhanBerencanaBrigadirRRditersangkakandenganPasal340KUHPjunctoPasal338junctoPasal55danPasal56KUHP.PasaliniberbedadengansangkaanpasalterhadapBharadaE,yakniPasal338junctoPasal55danPasal56KUHP.Priamengalamimasalahejakulasidini(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Ejakulasidinimerupakanproseskeluarnyaspermayangterjadilebihcepatdariyangdiharapkansaatberhubunganseksual.Priadianggapmengalamiejakulasidinibilasetelahsatumenitpenetrasi,tidakbisamenundaejakulasisaatberhubunganseksual,danmerasafrustrasiatautertekansehinggarelatifmenghindarikeintimanseksual.Janganabaikankondisiejakulasidini,karenabisamengganggukelancaranhubunganintim.Sebagailangkahawal,cobalakukancaramengatasiejakulasidinisendiriberikutini:BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBegini1.KomunikasikandenganPasanganSaatadamasalahejakulasidini,pasanganbisaterkenadampak.Tidakjarangiamenjadibingung,kesal,tidakpuas,dansebagainya.Komunikasikanlahmasalahejakulasidinidenganpasangan.Denganbegitu,masalahinidiharapkandapatbisasegerateratasidankeintimantetapterjaga.Seringkali,salahsatupenyebabejakulasidiniadalahmasalahdenganpasangan.Jikamasalahdapatdiselesaikan,diharapkanperformaseksualpunmembaik.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinya2.LakukanMasturbasiKemudian,caramengatasiejakulasidinisendiridirumahsecaraalamiadalahmasturbasi.Cobamasturbasi1-2jamsebelumberhubunganseksualdenganpasangan.3.LatihanSenamKegelAgartidakcepatkeluarsaatberhubungan,lakukansenamKegelsebagaicarauntukmengatasinya.PengacaraHotmanParismenyebutmasadepanBharadaEditentukansekarang.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismenyinggungsoalmasadepanBharadaE,tersangkatewasnyaBrigadirJ.HaltersebutberkaitandenganstatusBharadaEsebagaisaksikuncidalamkasuskematianBrigadirJ.MenurutHotmanParis,keterangandanpengakuandariBharadaEsangatlahpentingdalammengungkapkasusitu.BacaJuga:SiapaTersangkaBaruKasusBrigadirJ?HotmanParis:MungkinIrjenatauBrigjenPolisiMasadepanmuditentukansekaranginikarenakalaukamubuatpengakuansejujurnyamakapenyidikakanterbantuuntukmengungkapkanfaktasebenarnya,ujarHotmanmelaluiakunnyadiInstagramdikutippadaSelasa(9/8).PengacarabergayaparlenteitumengingatkanbebanyangharusditanggungBharadaEjikatakmengungkapkasussecarakeseluruhan.Lagi-lagi,rivalRazmanNasutionitumenyinggungsoalmasadepan.BacaJuga:HotmanParis:BharadaE,SayaPunyaIndraKeenam,Segeralah...Ingat,kalaubebannyahanyadikamu,bayangkanberatnyahukumandanmasadepanmumasihpanjangadikku,ucapHotmanParis.Olehkarenaitu,diamengimbauagarBharadaEbisamembuatpengakuanjujurdanmengungkapaktor-aktordibalikkasuskematianBrigadirJ.RumahpribadiFerdySamboyangtertutuprapatsaatPutriCandrawathimenjalanipemeriksaanolehLembagaPerlindunganSaksidanKorban(LPSK)diJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa(9/8).Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-IstriIrjenFerdySambo,PutriCandrawathimenjalaniassessmentpsikologisolehLembagaPerlindunganSaksidanKorban(LPSK),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaandilakukandikediamanpribadiIrjenFerdySamboyangberadadiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.DaripantauanJPNN.com,timLPSKtibadirumahpribadiFerdySambosekitarpukul10.20WIBmenaikimobilToyotaFortuner.BacaJuga:HotmanParis:Halo,BharadaE,KamuBisaSajaMerasaNyamandiTingkatPenyidikan,tetapiSekitar4orangdaritimLPSKlangsungmemasukirumahpribadiFerdySambo.RumahFerdySambosendiridikawalketatolehbeberapaorangyangmengenakanpakaiansipil.Sudahya,enggakenakdenganwarga(sekitar).Sayalelahmenjaga,menguruskaliansemua,katasalahsatuorangdenganpakaianpremankepadaawakmedia.BacaJuga:5PengakuanTerbaruBharadaE,ArahnyaSudahJelas,HariIniJenderalSigitUmumkanAktorPentingAwakmediayangberadadidepanrumahFerdySambotidakdiperbolehkanuntukmenunggudidepanrumahberlantai3itu.LPSKakanmemintaketeranganPutriCandrawathi,istrimantanKadivProvamPolriIrjenFerdySambo.

KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.

AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.

IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.

Marshanda.FotodokJPNN.comjpnn.com,JAKARTA-AktrisMarshandamengungkapfaktaterkaitkabardirinyayangdisebuthilangdiLosAngeles,Amerikaolehsahabatnya,SheilaSalsabila.Faktanya,ibusatuanakinimalahdimasukkankeRumahSakitJiwa(RSJ)danmendapatkanperlakukanyangtaksemestinya.KedatangannyakeLAsaatMarshandametimemaindidaerahpantai,VeniceBeachmalahmenjadibencanakarenadianggaphilang.BacaJuga:Jerinx:KalauEnggakKuatMental,Lama-lamaBisaGilaSaatitu,Sheilamenelepondirinyasebanyaktujuhkali.Sheilayangjugamemilikibipolar,mengalamipanickattackkarenatidakbisamenemukanMarshandadanlangsungmenghubungi911.Guetinggalinhpgue,karenagueenggakmauorangtahuguedimana,guemaumetime,ujarMarshandalewatchanelYouTubemiliknya.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiLalu,ambulansmendadakmenjemputnyadijalan.Guebingungkenapa(ambulans)jemputgue,yangpadaujung-ujungnya(guediantarke)rumahsakitjiwa,mentalhealth,sambungnya.PengacaraHotmanParismengimbauBharadaElakukanini.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-EntertainmentJPNNdiramaikandenganpemberitaanHotmanParisyangmengomentarikasuskematianBrigadirJ.PengacarakondnginimengimbauBharadaEagarmengungkapaktor-aktordibalikkasuskematianBrigadirJ.Selainitu,diajugamenyorotipentapanIrjenFerdySambosebagaitersangkatewasnyaBrigadirJ.BacaJuga:RazmanNasutionKembaliNyinyirSoalHotmanParis,KalimatnyaMenohokNamun,disela-selakehebohanitu,HotmanParisdibawakerumahsakitkarenamengalamikeracunanobat.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BharadaEDiimbauBeginiMenurutnya,keteranganjujurdariBharadaEdapatmemberikantitikterangbagikasuskematianBrigadirJ.BacaJuga:IqlimaKimBerupayaDamai,BagaimanaResponsHotmanParis?Olehkarenaitu,HotmanParismengimbauagarmemberikanketerangansecaraterangbenderang.Bacaselengkapnya:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenteriKoordinatorBidangPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDinginagarBhayangkaraDuaRichardEliezeratauBharadaEmendapatperlindungan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudmendorongPolriagarmemfasilitasiLembagaPerlindunganSaksidanKorban(LPSK)untukmemberikanperlindungankepadaBharadaE.Melaluimimbarini,sayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberikanperlindungankepadaBharadaE,agardiaselamatdaripenganiayaanatauapapun,sehinggapendampingandariLPSKitudiaturdengansedemikianrupaagarnantiBharadaEbisasampaikepengadilandanmemberikanketerangandipengadilan,kataMahfuddalamkonferensiperssebagaimanadipantaumelaluikanalYouTubeKemenkoPolhukamdiJakarta,Selasa.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanMahfudmengapresiasipengacaraBharadaE,yakniDeolipaYumarayangmengomunikasikansecarabaikmengenaihal-halyangsebenarnyadialamiolehkliennya.Sebelumnya,Rabu(3/8),PolritelahmenetapkanBharadaEsebagaitersangkadalamkasuskematianBrigadirYoshuaHutabaratatauBrigadirJ.Sampaihariini,selainBharadaE,Polrijugatelahmenetapkanbeberapatersangkalainnya,yaituBripkaRR,KM,danmantanKadivPropamPolriIrjenFerdySambo.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuKeempatnyadisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.Dalamkesempatanyangsama,MahfudpunmengatakansegeramenyampaikankepadaPolriagarkeluargaBrigadirJdiberikanperlindungansecaraprofesional.Ilustrasiesbatu.Foto:Pixabayjpnn.com-Esbatudisebut-sebutbisamenyembuhkanasamurat.Kebanyakanorangmengoleskanesbatukeareayangnyeriselamakira-kira10menit.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Lalubenarkahesbatubisamenyembuhkanasamurat?Faktanya,esbatutidakdapatmenyembuhkannyeriasamurat.Kompresesbergunahanyauntukmembantumeredakannyeriasamurat.Bukanuntukmenyembuhkanasamurat.Ketikaseseorangmemilikiasamuratyangtinggidanterjadireaksiperadangan,bagiantubuhyangterkenaakanmengalaminyeridanbengkak.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiSifatesbatuyangdinginbisamengurangireaksiperadanganakutpadakasusseranganasamurattersebut.Esbatuyangdikomprespadabagianyangsakitdapatmengecilkanpembuluhdarahyangmembesar.Cairan-cairanakibatperadangandansenyawa-senyawaproinflamasipunkemudianakanberkurang.Hasilnya,nyeriakanmenjadiberkurang.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaCaraTerapiEsBatuSaatAsamUratKambuhSaatmengompres,perhatikancaranyaagarlebihmaksimaldalammeminimalkannyeri.Bungkuspotongan-potonganesbatudalamhanduktipiskemudianletakkanpadasendiyangnyeriselama20hingga30menit.Andabisamelakukannyabeberapakalidalamsehari.

KapolriJenderalListyoSigitPrabowomengatakansoalmotifpembunuhanBrigadirJmasihdalamprosespendalamanolehtimsus.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenkoPolhukamMahfudMDmemahamikeputusankepolisianyangbelumbuka-bukaanmengungkapmotifkasuspenembakanterhadapNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudMDmendugamotifpembunuhanBrigadirJmasukunsursensitifdanhanyapantasdidengarolehorangdewasa.Mungkinhanyabolehdidengarolehorang-orangdewasa,kataMahfudMDdalamketeranganpersnya,Selasa(9/8).BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanMahfudmemercayaikepolisianuntukmengkonstruksimotifdalamkasuspenembakanBrigadirJdemikepentinganpenegakanhukum.DiapadaprinsipnyamengapresiasikepolisianyangmampumengungkapaktorintelektualdalamkasuskematiananggotaBrimobitu.Cumayangpentingsekarangtelurnyasudahpecah,ituyangkamiapresiasidariPolri,ujarmenterikelahiranSampang,Madura,itu.BacaJuga:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahMotifPembunuhanBrigadirJHarusDijelaskankePublikSementaraitu,anggotaKomisiIIIDPRRIAhmadAlimenyebutpentingbagiPolrimenyampaikanmotifkepadapublikdalamkasuspenembakanterhadapBrigadirJ.Menurutdia,pengungkapanmotifbisamenahanspekulasipublikdalamkasuspenembakanyangterjadidirumahdinasIrjenFerdySamboitu.TaqyMalikbersamaKabareskrimKomjenAgusAndrianto.Foto:Instagram/@taqy_malikjpnn.com,JAKARTA-SelebgramyangjugaseorangpengusahaAhmadTaqiyyunMalikataulebihdikenaldenganTaqyMalikikutangkatbicaraterkaitpenetapanIrjenFerdySambosebagaitersangkapembunuhBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.Timkhusus(timsus)bentukanKapolriJenderalListyoSigitPrabowomenjeratmantanKadivPropamPolriitudenganPasal340subsiderPasal338juntoPasal55dan56KUHPdenganancamanmaksimalhukumanmati.TerkaitperkembangankasuskematianBrigadirJyangakhirnyamenyeretoknumperwiratinggiPolrisebagaitersangka,TaqyMalikmemujisosokjenderalbintangtigainidansepakterjangnya.BacaJuga:IrjenFerdySamboTersangka,AdayangKhawatirNyawaBharadaETerancamSosoktersebutadalahKepalaBadanReserseKriminal(Kabareskrim)PolriKomjenAgusAndriantoyangjugatergabungdalamtimsusbentukanKapolritersebut.BravoKomjenAgus,sosokyangsederhana,berwibawa,dantegas,kataTaqyMalikmelaluiakunpribadinyadiInstagram,yangdikutipRabu(10/8).SuamidariSherelThalibituberharappenetapanIrjenFerdySambodapatterusmenjagakepercayaanpublikterhadapinstitusiPolri.BacaJuga:IrjenFerdySambodiMataKeluargaBrigadirJ,SemuaTerkejutFerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretSemogainstansiPolriterusterjagacitranya,Bravo!,ujarmantanmenantupengacarakondangSunanKalijagaitu.(mar1/jpnn)Yuk,SimakJugaVideoini!

KapolriJenderalListyoSigitPrabowosaatmengumumkanFerdySambosebagaitersangkapembunuhanBrigadirJdiMabesPolri,Selasa(9/8)malam.TampakjugadisampingSigitadaIrwasumKomjenAgungBudiMaryotodanKabareskrimKomjenAgusAndrianto.Foto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KepalaBadanReserseKriminalPolriKomisarisJenderalAgusAndriantomenanggapipertanyaanwartawanseputarkasusdugaanpelecehanseksual,yangdilakukanBrigadirYosuaHutabarata.k.aBrigadirJterhadapistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomjenAgusAndriantomenjawabpertanyaansoalperkembangankasusdugaanpelecehanseksualituseusaikonferensipersdiMabesPolri,Selasa(9/8)malam.MenurutjenderalbintangtigakelahiranBlora,16Februari1967tersebut,kecilkemungkinanterjadipelecehanseksualjikaPasal340KUHP(tentangpembunuhanberencana)diterapkandalamkasuspembunuhanBrigadirJ.BacaJuga:IstriFerdySamboAkanDibawakeRuanganKhususKalau(pasal)340diterapkan,kataAguslalusempatterdiam.Kalau340diterapkan,Agusmengulangkalimatnyadankembalidiamsejenak.Agusakhirnyaberkata.Kecilkemungkinanterjadiitu,ujarnyalantasberlalu.BacaJuga:RaguSoalIstriIrjenFerdySambo,Kamaruddin:PutriyangTertukar?DugaanpelecehanseksualmenjadipemicuawalmunculatautersiarnyaperistiwadirumahIrjenFerdySamboyangkiniresmidisebutpenembakan,bukantembak-menembak.KasusdugaanpelecehanseksualitusendiridisebutdilaporkanPutriCandrawathikePolresJakartaSelatan.KemudiankasusituditarikkePoldaMetroJayadankiniadaditanganBareskrimPolri.PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirektoratLaluLintasPoldaMetroJayamemberikanpelayananSIMkelilingbagipemilikdokumentersebutyangmasaberlakunyaakansegerahabis.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SIMatauSuratIzinMengemudisendirimemilikimasaberlaku5tahunsejakditerbitkan.PoldaMetroJayamenyiapkan5gerailayananSIMyangtersebardi4wilayahDKIJakartapadaRabu(10/8).BacaJuga:Catatnih,5LokasiLayananSIMKelilingdiJakartaHariIni,Selasa9Agustus2022Dilansirdariakunresmi@TMCPoldaMetrodiTwitter,layananSIMKelilingituberoperasimulaipukul08.00hinggapukul14.00WIB.WargaJakartaPusatyanginginmemperpanjangSIMbisadatangkeKantorPosLapanganBanteng.Lalu,wargayangberdomisilidiJakartaSelatanbisamenujukeKampusTrilogiKalibata.BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaTimuryanginginmemperpanjangSIMtersediadiMallGrandCakung.LokasipelayanantersebutjugatersediadiLTCGlodokdanMalCitraland

HotmanParisbicarasoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisternyatasempatmemprediksisoaltersangkabarudalamkasuskematianBrigadirJ.Diameyakiniadanyapenetapantersangkabarumerujukdarikasustersebutyangmakinterbuka.Inikasussudahmulaiterbukaluas.Yakinsayadalamwaktudekatpenyidikatautimsusakanmengumumkantersangkadariperwirapolisi,ujarHotmanParismelaluiakunnyadiInstagram,dikutipRabu(10/8).RivalRazmanNasutionitumengakusudahmelihatkemungkinantersebutdaritigaharibelakangan.Sebabmenurutnya,halituterlihatjelasdariarahpenyidikan.BacaJuga:IrjenFerdySamboDitetapkansebagaiTersangka,HotmanParisBilangBeginiKelihatanjelasitudariarahpenyidikanselamatigahariini,kataHotmanParis.Dia,bahkanmenyebutjumlahtersangkabaruyangkemungkinandiumumkanolehKapolri.MungkinitudariIrjenmaupunBrigjenpolisidaninisayamelihatbukancumasatuatauduaorang,bisatigaorang.Inianalisasaya,ucapHotmanParis.BacaJuga:AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ,BeginiKatanyaTerbaru,timkhusus(timsus)PolrimenetapkanIrjenFerdySambosebagaitersangkakasuskematianBrigadirNofryansahYosuaHutabarataliasBrigadirJ.KapolriJenderalListyoSigitPrabowomengatakanpenetapantersangkaterhadapmantanKadivPropamitudilakukansetelahpenyidikmelakukangelarperkaraSelasa(9/8).Ilustrasi-KeluargaBrigadirJ.Foto:MRidwan/JambiEkspresjpnn.com,JAMBI-AyahalmarhumBrigadirJ,SamuelHutabaratmengakuterkejutsaatKapolriJenderalListyoSigitmengumumkanotakpenembakanterhadapanaknyaialahIrjenPolFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayasebagaiayahYoshua(BrigafirJ,red)tidakmenyangkajikapelakuutamanyaadalahFerdySambodanterkejutmendengarkanpengumumandarikapolri,ucapSamuelHutabarat,diMuaroJambi,Selasakemarin.KeluarganyajugatidakmenyangkajikakejadianberdarahitudilakukanatasperintahFerdySambo.BacaJuga:JumlahPolisiLanggarKodeEtikdalamPenangananKasusBrigadirJBertambahLagi,Alamak!SelamainianakkamiYoshuayangsudahbekerjaselamaduasetengahtahundenganPakFerdySambotidakpernahmengeluhataspekerjaannyadanmungkindisimpannya,agarkeluargatidakmengetahuinya,imbuhdua.SepanjangBrigadirJberkomunikasidengankeluarga,menurutSamuel,putranyaitutakpernahmengatakanhal-halburukselamamenjadiajudanIrjenFerdy.SaatberkomunikasidengankeluargadiJambi,anakkamiYoshuatidakpernahmembebanipikirankami.BacaJuga:MotifPembunuhanBrigadirJHanyaPantasDidengarOrangDewasa?Ah,TelurnyaSudahPecahBegitujugaketikadiapulangkeJambitidakpernahmengatakanhalyangburukdandiaselalumenceritakanyangbaiksaja,ucapSamuel.KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakanterhadapBrigadirJ.

VivoX60Pro.ilustrasiFoto:VivoIndonesiajpnn.com,TIONGKOK-Vivodiam-diamakanmerilissmartphonekeluargadariseriX,yakniX80Lite.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});HalituterungkapdarisetelahnamaVivoX80LiteitudidatabaseGoogleSupportedDevices.TidakhanyaX80Lite,VivoakanmengenalkanHPterbarudalamjajaranIQOOSeries.BacaJuga:VivoX80SeriesResmiDijualdiIndonesia,PalingMurahRp11JutaPonselyangdiberinamaiQOOZ6xitumunculdengannomormodelV2164KA.Hanyasaja,belumadainformasimengenaispesifikasipadaperangkattersebut.Gizmochina,Rabu(10/8),melaporkanZ6xakanbergabungdengankeluargaZ6,yangmencakupiQOOZ65G,iQOOZ6Pro5G,daniQOOZ644W.BacaJuga:VivoY305GMeluncurdengan2KameraBelakang,SebeginiHarganyaPonselseriZ6telahdiubahnamanyamenjadiversiseriVivoT1diIndia.Olehkarenaitu,adakemungkinaniQOOZ6xbisamenjadiversirebrandeddariVivoT1x,yangbaru-baruinimemulaidebutnyadiIndia.GubernurJawaTengahGanjarPranowoNgomonginPolitika.k.aNgompolJPNN.com,diJakarta.Foto:Ricardo/JPNNjpnn.com,JAKARTA-DirekturEksekutifIndoStrategicAkhmadKhairulUmammenyadariGanjarPranowoseksidilantaibursaPilpres2024.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Ganjar,sigubernurdariPDIPerjuanganitumemimpinklasemenelektabilitassurveipilpres.Namun,UmammenilaiGanjarbelumberadadifasemendominasi.MasihadaPrabowoSubiantodanAniesBaswedanyangjugamenggoda.BacaJuga:KomunitasOjoldiJakartaUtaraSuarakanGanjarPranowoPresiden2024GanjarmewakilikarakteristikkeberlanjutandarikepemimpinanJokowi,tetapikendalanyadiabukanpemegangkekuatanutama.Adadinamikayangcukupserius.ApakahPDIPmengusungGanjaratautidak?kataUmamdalamdiskusiGanjarBakalTumbangJikaKeluarKandang?yangdiselenggarakanLingkarDiskusiIndonesiadiBakoelKoffie,Rabu(10/8).UmambilangGanjarPranowomasihpunyapilihanskema.DiantaranyadengantetapberadadiPDIP.ElektabilitasGanjardiJawaTengahcukuptinggi,tetapitidakadagapyangsignifikandenganSudirmanSaiddanIdaFauziah,hanyasekitar6-7persen.ElektabilitasGanjarsaatitu(pilgub)tidakberarti,kemenangannyamelaluimesinPDIP,tuturUmam.BacaJuga:RibuanPemudaKapuasDeklarasikanDukunganKepadaGanjarPranowoDiamelanjutkan,GanjarjugabisajalandengankendaraanKoalisiIndonesiaBersatu,tetapiituakanmembuatKetumPDIPMegawatiSoekarnoputribertambahberang.KononGanjarpernahkenasentilBuMegadisebuahrakernasPDIP.ParapengurusGLPGPPPKpusatdandaerahsaatberaudiensidenganpejabatKemendikbudristek.FotodokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-KetumForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimenyampaikanhasilpertemuandenganpejabatKemendikbudristek.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PertemuandihadiriSekretarisDitjenGuruTenagaKependidikan(GTK)KementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)NunukSuryani,KabidPerencanaanGTKAndika.JugaparapenguruspusatGLPGPPPKdiantaranyaIswadi,Nuri,Fulkan,danbeberapaperwakilandaerah.DalampertemuanyangdilaksanakandiKantorKemendikbudristekpadaRabu(10/8),terungkapsejumlahinformasipentingdaripejabatKemendikbudristek,yaitu:BacaJuga:BesokGuruLulusPGDiterimaPejabatKemendikbudristek,SemogaAdaSolusiTerbaik 1.Dataexcelyangberedarmengenaipenempatanbynamabyaddressadalahtidakbenarkarenaituadalahmasihsimulasi.2.KuotaPPPKyangdiajukanpanselnaskepadaPemdasudahfinal.3.ByNamebyaddresspenempatanPPPKbelumfinal.BacaJuga:GuruLulusPGMasukPendataanHonorer,PenjelasanPanselnasBikinTenang4.JuknispelaksanaanPPPKrekrutmentahun2002turunawalSeptember.MenurutIswadi,hasilaudiensihariinibelummemuaskangurululusPG.Sebab,masihbanyakyangtidakbisaditempatkan,yaitugurubahasaInggrisdanPKWU.LembagaPerlindunganSaksidanKorban.Foto:Ricardo/JPNN.comjpnn.com,CIRACAS-WakilKetuaLembagaPerlindunganSaksidanKorban(LPSK)EdwinPartogiPasaribumembukaucapanyangkeluardarimulutistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ucapanitutakpanjang.Yangterucaphanyaitu.Malu,Mbak.Malu.kataEdwinkepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).BacaJuga:SehariSebelumMenjadiTersangkaPembunuhanBrigadirJ,FerdySamboBerhadapandengan2KomjenIniMalunyakenapakamienggaktahu,imbuhnya.BuPutrimengatakanitusaatdiperiksatimasesmenpsikologisLPSKdikediamanpribadiSambodiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa.EdwinjugamengungkapkondisimentalNyonyaSambomemprihatinkan.BacaJuga:PagiPresidenJokowiUnggahPernyataanTegas,MalamnyaFerdySamboTersangkaIbuPsukamenangis,murung,tidakbisamemberiketerangan.Adahallainyangspesifikdiobservasipsikiater,tuturEdwin.LPSKmenilaipsikologisPutriCandrawathimasihperluperhatian.

IstriIrjenFerdySambo,PutriCandrawathi.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTASELATAN-PutriCandrawathi,istriIrjenFerdySamboturutmenyaksikansaatpenyidiktimkhusus(timsus)PolrimenggeledahrumahpribadinyadiRT07RW02JalanSaguling,KompleksPertambangan,DurenTiga,Pancoran,JakartaSelatan(Jaksel),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ketuarukuntanggasetempat,YosefmengatakanPutrihanyamenangisketikapenyidikmenggeledah.Iya,diamenangisterusdikamar,susahkamiberkomunikasi,kataYosefdikutipdariAntara,Rabu(10/8).BacaJuga:KPKBelumBisaUmumkanHartaKekayaanIrjenFerdySambo,AdaApa?YosefmengatakandirinyadimintaikuthadirdalamprosespenggeledahanbersamatimkhususpadaSelasa.KetikaitukeadaanPutriterlihatbaik-baiksajanamunpengacaramenyebutnyamenangisterusdidalamkamar.Yosefmengakumelihatadabeberapaorangyaknipengacara,polisiwanita(polwan),danBareskrimikutdalamprosespenggeledahanselamasembilanjam.BacaJuga:BenarkahPutriCandrawathiMengalamiPelecehanSeksual?IniKataKabareskrimAdajugakeduaanakFerdySambodanPutriyakniseoranganakperempuandananaklelakinyapalingkecilberumur1,5tahunbersamapengasuhnyajugaberadadidalamrumah.KeluargaFerdySambotinggaldirumahtersebutkuranglebihsetahunsehinggabelumterlalumengenalkawasanJalanSaguling.ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,KabupatenBekasi,JawaBarat,yangmerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.ANTARA/HO-PolresSerangjpnn.com,SERANG-ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,Bekasi,JawaBarat.DiadidugamerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.PelakuperampokanituberinisialIB(29)wargaBekasi,kataKapolresSerangAKBPYudhaSatriadiSerang,Rabu(10/8).PeristiwaperampokanterjadipadahariSabtu(6/8)pukul22.30WIB.Saatitu,tokobarututupdansejumlahkaryawansudahpulang.BacaJuga:4MalingMotorDiringkusPolisi,PengakuanMerekaMencengangkanPelakuyangmenggunakantopengdangolokitulangsungmenerobosmasuktokolewatpintubelakang.PelakumasukdanlangsungmenodongkangolokkekorbandanmengeluarkanplastikagarkorbanmemasukkanHPdanuang,kataYudha.PemiliktokoNH(41)pasrahmenghadapiancamanperampokyangakanmembacoknya,kemudianmenyerahkanuangRp100jutakedalamkantongplastik.Padasaatitu,pelakumemintakorbanagarmenyerahkanseluruhhandphone.Namunkorbanmenyebutkanbahwaseluruhponselsudahdimasukkankedalambrankas.Pelakuhanyamendapatkanuanglalukeluartokodanmenguncikorbandariluar,kataYudhaSatria.BacaJuga:PerampokBersenpidiApotekMedanAmbrukDiterjangTimahPanas,Bravo,PakPolisiPerampokBersenjatadiApotekDitembakPolisiDalammengungkapkasusitu,polisihanyamembutuhkanwaktuempathari.PolisimenangkapIBditempatkerjanya,Selasa(9/8).Darihasilpenggeledahan,kataYudha,petugasmengamankansejumlahbarangbukti,antaralainsatuunitHondaVario,duacincinemas,duaponsel,sertasejumlahalatuntukmerampok.(antara/jpnn)BeritaSelanjutnya:IdentitasPerampokyangMenewaskanSopirTaksiOnlineSudahDikantongi,Siap-SiapSaja

BekRealMadrid,DavidAlaba(jerseiputih)saatmelawanpemainEintrachtFrankfurt(jerseihitam)difinalUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridmenasbihkandirinyasebagaiRajaEropasetelahmempermalukanEintrachtFrankfurtdifinalUEFASuperCup2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Duagolyangmasing-masingdilesatkanolehDavidAlaba(37)danKarimBenzema(65)membawaMadridunggul2-0padalagayangdihelatdiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB.JalannyaPertandinganBacaJuga:PengamatMintaPSMMakassarWaspadaiKualaLumpurCityFC,IniPemicunyaMadridlangsungtancapgassejakmenitawal.JawaraLigaChampionsituterusmencecarpertahananFrankfurtselakukampiunLigaEuropa.Namun,Madridbarubisamembukakeunggulanpadamenit37.UmpandariCasemiromampudituntaskanmenjadigololehAlabasehinggapapanskorberubahmenjadi1-0hinggaturunminum.Dalamkeadaantertinggal,FrankfurtberupayauntukmenekanMadrid.Akantetapi,skortetaptidakberubah.ElRealtetapmemimpin1-0.BacaJuga:BawaIndonesiakeFinalPialaAFFU-162022,BimaSaktiKokMintaMaaf,AdaApa?Padababakkedua,Madridtampakmasihlebihmendominasi.FrankfurtmasihsajakesulitanmenembuspertahanananLosBlancosyangdikawalduetDavidAlabadanEderMilitao.Madridkemudianmenambahkeunggulannyamenit65.AsisstViniciusJuniordisambutdengansepakanmendatarolehKarimBenzemayangtakmampudihalaukiperFrankfurt,KevinTrapp.KuasahukumkeluargaBrigadirJatauNofryansahYosuaHutabarat,KamaruddinSimanjuntak(kanan)danJohnsonPanjaitandiBareskrimPolribeberapawaktuyanglalu.Foto:Ricardojpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangRabu(10/8)tentangsebuahmisterikepemilikansenjatauntukmembunuhBrigadirJterungkap,satudariempattersangkapembunuhanBrigadirJmuncul,hinggaperintahFerdySamboparah.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahBacaJuga:5BeritaTerpopuler:5PengakuanTerbaruBharadaETerungkap,LPSKMendadakBungkam,KomjenAgusMeresponsTegasMisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:5BeritaTerpopuler:BharadaELegaMembongkarKasusBrigadirJ,AdaRahasiaBesarhinggaUrusanCintaBacaselengkapnya,kliklinkdibawah:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,Parah

AjudanIrjenFerdySambo,BhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KetuaIndonesiaPoliceWatch(IPW)SugengTeguhSantosomendukunglangkahKapolriJenderalListyoSigitPrabowoterkaitpenanganankasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KasusituinisemuanyaditanganiBareskrimPolri,mulaidarikasuskematian,dugaanpembunuhanberencanaterhadapBrigadirJ.KemudiandugaanpelecehandanancamanpembunuhanyangdialamiPutriCandrawathi,istriIrjenFerdySambo.MenurutSugeng,sudahsaatnyaPolrimenjeladlankepadapublikapayangsebenarnyaterjadidalaminsidenbakutembakdirumahIrjenFerdySamboitu.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanSugengmenyebuthalituperlukarenaBrigadirJdanBharadaEbukanyangsebatasajudanIrjenFerdySambo.KeduapolisiitumerupakananggotaSatuanTugasKhusus(Satgassus)PolribentukanKapolri.DaripenelusuranIPW,BrigadirJyangtewasditembakmerupakananggotasatgassus.LaluBharadaRichardEliezerjugaanggotasatgassus,kataSugeng.BacaJuga:BeginiPengakuanAjudanFerdySambosoalBrigadirJMenodongkanPistolKemudianinsidenberdarahiniterjadidirumahdinasIrjenFerdySamboyangjugasebagaiKetuaSatgassusPolritersebut.Olehsebabitu,KapolriharustegasmenanganikasusinisesuaiperintahPresidenJokowiuntukdiproseshukum,terbuka,danjanganditutup-tutupi,ujarSugeng.PenampakanpesawatelektrikEHang216yangberencanadioperasikansebagaitransportasiumumdiIndonesia.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengusahaRudiSalimberencanamembangunbisnistaksiterbangdiIndonesia.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601110242209-0);});SahabatRaffiAhmaditubakalmenjadikanpesawatelektrikEhang216sebagaitaksiterbang.LantasberapasebenarnyahargaEhang216?BacaJuga:BamsoetDukungPengadaanEHang216sebagaiOfficialAircraftIMIRudiSalimengganblak-blakanmengenaihargaasliEhang216.Namun,diamembuatperumpamaanterkaithaltersebut.Kisaranlebihmurahdarisupercar,deh,pokoknya,kataRudiSalimsaatditemuidikawasanKemayoran,JakartaPusat,Minggu(31/7).RudiSalimmengatakanbiayaperawatanEhang216jugatergolonglebihmurahdaripadapesawatkonvensional.BacaJuga:RudiSalimBerencanaBangunBisnisTaksiTerbangdiIndonesiaSebab,Ehang216beroperasimenggunakandayalistrik.Tenagalistrikyangdiperlukanuntuksatupesawateletrikinijugadisebuttidakbesar.Jadi,sangataffordable,imbuhnya.

Tags

Artikel Terkait

badakslot link alternatif

芭芭拉史翠姗

badakslot link alternatif

Nz5Jiie

2022-08-11 09:43
1106 min read
judi cash 78

叶瑷菱

judi cash 78

G7X8iPE

2022-08-11 09:08
1381 min read
online gambling book of ra

朱紫娆

online gambling book of ra

g9hNy9V

2022-08-11 09:00
1240 min read

Terpopuler Bulan Ini

01

main judi gaple

模糊乐队

2022-08-11 09:22
319 min read
02

agen slot 303

段千寻

2022-08-11 09:20
739 min read
03

permainan judi domino

吴君如

2022-08-11 08:52
1940 min read
04

gw99 2 demo id

倪虹洁

2022-08-11 08:22
2395 min read
05

www pasaran bola

李濠

2022-08-11 07:35
1088 min read